TBC1D26 anticorps (Middle Region)

N° du produit ABIN632465

Détail du produit anti-TBC1D26 anticorps

Antigène: TBC1D26 (TBC1 Domain Family, Member 26 (TBC1D26))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TBC1D26 est non-conjugé

Application: Western Blotting (WB)

Specificité: MGC51025 antibody was raised against the middle region of Mgc51025

Purification: Affinity purified

Immunogène: MGC51025 antibody was raised using the middle region of Mgc51025 corresponding to a region with amino acids RGRAWSLLLDIDRIKSQNPGKYKVMKEKGKRSSRIIHCIQLDVSHTLQKH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MGC51025 Blocking Peptide, catalog no. 33R-7932, is also available for use as a blocking control in assays to test for specificity of this MGC51025 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC51025 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TBC1D26

Antigène: TBC1D26 (TBC1 Domain Family, Member 26 (TBC1D26))

Abstract: TBC1D26 Produits

Synonymes: anticorps TBC1 domain family member 26, anticorps TBC1D26

Sujet: MGC51025 may act as a GTPase-activating protein for Rab family proteins.

Poids moléculaire: 29 kDa (MW of target protein)