TBC1D26 anticorps (Middle Region)
-
- Antigène Voir toutes TBC1D26 Anticorps
- TBC1D26 (TBC1 Domain Family, Member 26 (TBC1D26))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TBC1D26 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MGC51025 antibody was raised against the middle region of Mgc51025
- Purification
- Affinity purified
- Immunogène
- MGC51025 antibody was raised using the middle region of Mgc51025 corresponding to a region with amino acids RGRAWSLLLDIDRIKSQNPGKYKVMKEKGKRSSRIIHCIQLDVSHTLQKH
- Top Product
- Discover our top product TBC1D26 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MGC51025 Blocking Peptide, catalog no. 33R-7932, is also available for use as a blocking control in assays to test for specificity of this MGC51025 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC51025 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TBC1D26 (TBC1 Domain Family, Member 26 (TBC1D26))
- Abstract
- TBC1D26 Produits
- Synonymes
- anticorps TBC1 domain family member 26, anticorps TBC1D26
- Sujet
- MGC51025 may act as a GTPase-activating protein for Rab family proteins.
- Poids moléculaire
- 29 kDa (MW of target protein)
-