KCTD9 anticorps (Middle Region)
-
- Antigène Tous les produits KCTD9
- KCTD9 (Potassium Channel Tetramerisation Domain Containing 9 (KCTD9))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCTD9 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCTD9 antibody was raised against the middle region of KCTD9
- Purification
- Affinity purified
- Immunogène
- KCTD9 antibody was raised using the middle region of KCTD9 corresponding to a region with amino acids AHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFEDPSG
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCTD9 Blocking Peptide, catalog no. 33R-1239, is also available for use as a blocking control in assays to test for specificity of this KCTD9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCTD9 (Potassium Channel Tetramerisation Domain Containing 9 (KCTD9))
- Autre désignation
- KCTD9 (KCTD9 Produits)
- Synonymes
- anticorps zgc:101020, anticorps KCTD9, anticorps MGC159927, anticorps kctd9, anticorps AA675328, anticorps AI854539, anticorps BTBD27, anticorps potassium channel tetramerization domain containing 9, anticorps potassium channel tetramerization domain containing 9b, anticorps potassium channel tetramerization domain containing 9a, anticorps potassium channel tetramerization domain containing 9 S homeolog, anticorps potassium channel tetramerisation domain containing 9, anticorps KCTD9, anticorps kctd9b, anticorps kctd9a, anticorps kctd9.S, anticorps kctd9, anticorps Kctd9
- Sujet
- The function of KCTD9 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 42 kDa (MW of target protein)
-