ACP5 anticorps (N-Term)

N° du produit ABIN632484

Détail du produit anti-ACP5 anticorps

Antigène: ACP5 (Acid Phosphatase 5, Tartrate Resistant (ACP5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACP5 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACP5 antibody was raised against the N terminal of ACP5

Purification: Affinity purified

Immunogène: ACP5 antibody was raised using the N terminal of ACP5 corresponding to a region with amino acids DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACP5 Blocking Peptide, catalog no. 33R-2079, is also available for use as a blocking control in assays to test for specificity of this ACP5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACP5

Antigène: ACP5 (Acid Phosphatase 5, Tartrate Resistant (ACP5))

Autre désignation: ACP5 (ACP5 Produits)

Synonymes: anticorps SPENCDI, anticorps TRAP, anticorps acp5, anticorps sb:cb576, anticorps zgc:63825, anticorps wu:fb19f01, anticorps wu:fb30b03, anticorps wu:fi14e01, anticorps wu:fj66f03, anticorps MGC78938, anticorps MGC89674, anticorps TR-AP, anticorps zgc:92339, anticorps TRACP, anticorps TTRRAP, anticorps Trap, anticorps UF, anticorps acid phosphatase 5, tartrate resistant, anticorps acid phosphatase 5a, tartrate resistant, anticorps acid phosphatase 5, tartrate resistant S homeolog, anticorps tartrate resistant acid phosphatase, anticorps Tartrate-resistant acid phosphatase type 5, anticorps tartrate-resistant acid phosphatase type 5, anticorps acid phosphatase 5b, tartrate resistant, anticorps ACP5, anticorps acp5a, anticorps acp5.S, anticorps acp5, anticorps NAEGRDRAFT_81291, anticorps ppa5, anticorps LOC100282899, anticorps acp5b, anticorps Acp5

Sujet: This gene encodes an iron containing glycoprotein which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is the most basic of the acid phosphatases and is the only form not inhibited by L(+)-tartrate.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis