SPATA6 anticorps (Middle Region)

N° du produit ABIN632524

Détail du produit anti-SPATA6 anticorps

Antigène: SPATA6 (Spermatogenesis Associated 6 (SPATA6))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPATA6 est non-conjugé

Application: Western Blotting (WB)

Specificité: SPATA6 antibody was raised against the middle region of SPATA6

Purification: Affinity purified

Immunogène: SPATA6 antibody was raised using the middle region of SPATA6 corresponding to a region with amino acids SQKKKSKSPERSKYCINAKNYEQPTISSKSHSPSPYTKRRMCELSEDTRR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPATA6 Blocking Peptide, catalog no. 33R-8715, is also available for use as a blocking control in assays to test for specificity of this SPATA6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPATA6

Antigène: SPATA6 (Spermatogenesis Associated 6 (SPATA6))

Autre désignation: SPATA6 (SPATA6 Produits)

Synonymes: anticorps HASH, anticorps SRF-1, anticorps SRF1, anticorps 1700062C23Rik, anticorps AI790763, anticorps Hash, anticorps KRP, anticorps Mash, anticorps spermatogenesis associated 6, anticorps SPATA6, anticorps Spata6

Sujet: SPATA6 belongs to the SPATA6 family. SPATA6 may play a role in spermatid maturation or sperm function.

Poids moléculaire: 54 kDa (MW of target protein)