ZC2HC1C anticorps (N-Term)

N° du produit ABIN632527

Détail du produit anti-ZC2HC1C anticorps

Antigène: ZC2HC1C (Zinc Finger, C2HC-Type Containing 1C (ZC2HC1C))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZC2HC1C est non-conjugé

Application: Western Blotting (WB)

Specificité: C14 ORF140 antibody was raised against the N terminal Of C14 rf140

Purification: Affinity purified

Immunogène: C14 ORF140 antibody was raised using the N terminal Of C14 rf140 corresponding to a region with amino acids QQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFPLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C14ORF140 Blocking Peptide, catalog no. 33R-7690, is also available for use as a blocking control in assays to test for specificity of this C14ORF140 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF140 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZC2HC1C

Antigène: ZC2HC1C (Zinc Finger, C2HC-Type Containing 1C (ZC2HC1C))

Autre désignation: C14ORF140 (ZC2HC1C Produits)

Synonymes: anticorps C14orf140, anticorps FAM164C, anticorps 2810002I04Rik, anticorps AV046379, anticorps Fam164c, anticorps RGD1307122, anticorps zinc finger C2HC-type containing 1C, anticorps zinc finger, C2HC-type containing 1C, anticorps ZC2HC1C, anticorps Zc2hc1c

Sujet: C14orf140 belongs to the UPF0418 family. The exact function of C14orf140 remains unknown.

Poids moléculaire: 31 kDa (MW of target protein)