CCSAP anticorps (Middle Region)
-
- Antigène Tous les produits CCSAP
- CCSAP (Centriole, Cilia and Spindle Associated Protein (CCSAP))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CCSAP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C1 orf96 antibody was raised against the middle region of C1 rf96
- Purification
- Affinity purified
- Immunogène
- C1 orf96 antibody was raised using the middle region of C1 rf96 corresponding to a region with amino acids ENKHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEK
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C1orf96 Blocking Peptide, catalog no. 33R-2609, is also available for use as a blocking control in assays to test for specificity of this C1orf96 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf96 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CCSAP (Centriole, Cilia and Spindle Associated Protein (CCSAP))
- Autre désignation
- C1orf96 (CCSAP Produits)
- Synonymes
- anticorps C1orf96, anticorps CSAP, anticorps 1700054N08Rik, anticorps AI853424, anticorps centriole, cilia and spindle associated protein, anticorps CCSAP, anticorps Ccsap
- Sujet
- The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 30 kDa (MW of target protein)
-