DNAJC12 anticorps

N° du produit ABIN632555

Détail du produit anti-DNAJC12 anticorps

Antigène: DNAJC12 (DnaJ (Hsp40) Homolog, Subfamily C, Member 12 (DNAJC12))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DNAJC12 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DNAJC12 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DNAJC12 Blocking Peptide, catalog no. 33R-2668, is also available for use as a blocking control in assays to test for specificity of this DNAJC12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DNAJC12

Antigène: DNAJC12 (DnaJ (Hsp40) Homolog, Subfamily C, Member 12 (DNAJC12))

Autre désignation: DNAJC12 (DNAJC12 Produits)

Synonymes: anticorps DNAJC12, anticorps JDP1, anticorps Jdp1, anticorps mJDP1, anticorps DnaJ heat shock protein family (Hsp40) member C12, anticorps DnaJ (Hsp40) homolog, subfamily C, member 12, anticorps DNAJC12, anticorps dnajc12, anticorps Dnajc12

Sujet: This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene.

Poids moléculaire: 23 kDa (MW of target protein)