UBE2O anticorps (Middle Region)

N° du produit ABIN632557

Détail du produit anti-UBE2O anticorps

Antigène: UBE2O (Ubiquitin-Conjugating Enzyme E2O (UBE2O))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2O est non-conjugé

Application: Western Blotting (WB)

Specificité: UBE2 O antibody was raised against the middle region of UBE2

Purification: Affinity purified

Immunogène: UBE2 O antibody was raised using the middle region of UBE2 corresponding to a region with amino acids YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE2O Blocking Peptide, catalog no. 33R-10192, is also available for use as a blocking control in assays to test for specificity of this UBE2O antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE2O

Antigène: UBE2O (Ubiquitin-Conjugating Enzyme E2O (UBE2O))

Autre désignation: UBE2O (UBE2O Produits)

Synonymes: anticorps e2-230k, anticorps E2-230K, anticorps 9630022H21, anticorps B230113M03Rik, anticorps mKIAA1734, anticorps RGD1310297, anticorps ubiquitin conjugating enzyme E2 O, anticorps ubiquitin-conjugating enzyme E2O, anticorps UBE2O, anticorps ube2o, anticorps Ube2o

Sujet: UBE2O catalyzes the covalent attachment of ubiquitin to other proteins.

Poids moléculaire: 141 kDa (MW of target protein)