PNMA-Like 1 anticorps (Middle Region)
-
- Antigène Tous les produits PNMA-Like 1 (PNMAL1)
- PNMA-Like 1 (PNMAL1)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PNMA-Like 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PNMAL1 antibody was raised against the middle region of PNMAL1
- Purification
- Affinity purified
- Immunogène
- PNMAL1 antibody was raised using the middle region of PNMAL1 corresponding to a region with amino acids APMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQ
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PNMAL1 Blocking Peptide, catalog no. 33R-1430, is also available for use as a blocking control in assays to test for specificity of this PNMAL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNMAL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PNMA-Like 1 (PNMAL1)
- Autre désignation
- PNMAL1 (PNMAL1 Produits)
- Synonymes
- anticorps RGD1310803, anticorps DKFZp459A1032, anticorps DKFZp459P0514, anticorps 0710005I19Rik, anticorps paraneoplastic Ma antigen family member 8A, anticorps PNMA family member 8A, anticorps PNMA-like 1, anticorps Pnma8a, anticorps PNMA8A, anticorps PNMAL1, anticorps Pnmal1
- Sujet
- The function of PNMAL1 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 48 kDa (MW of target protein)
-