PNMA-Like 1 anticorps (Middle Region)

N° du produit ABIN632561

Détail du produit anti-PNMA-Like 1 anticorps

Antigène: PNMA-Like 1 (PNMAL1)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PNMA-Like 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PNMAL1 antibody was raised against the middle region of PNMAL1

Purification: Affinity purified

Immunogène: PNMAL1 antibody was raised using the middle region of PNMAL1 corresponding to a region with amino acids APMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PNMAL1 Blocking Peptide, catalog no. 33R-1430, is also available for use as a blocking control in assays to test for specificity of this PNMAL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNMAL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PNMA-Like 1

Antigène: PNMA-Like 1 (PNMAL1)

Autre désignation: PNMAL1 (PNMAL1 Produits)

Synonymes: anticorps RGD1310803, anticorps DKFZp459A1032, anticorps DKFZp459P0514, anticorps 0710005I19Rik, anticorps paraneoplastic Ma antigen family member 8A, anticorps PNMA family member 8A, anticorps PNMA-like 1, anticorps Pnma8a, anticorps PNMA8A, anticorps PNMAL1, anticorps Pnmal1

Sujet: The function of PNMAL1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 48 kDa (MW of target protein)