PNMA-Like 1 anticorps (Middle Region)

N° du produit ABIN632561

L’anticorps anti-PNMA-Like 1 Polyclonal Lapin est utilisé pour la détection de PNMA-Like 1 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour PNMA-Like 1 anticorps (Middle Region) (ABIN632561)

Antigène: PNMA-Like 1 (PNMAL1)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PNMA-Like 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PNMA-Like 1 anticorps

Épitope: Middle Region

Specificité: PNMAL1 antibody was raised against the middle region of PNMAL1

Purification: Affinity purified

Immunogène: PNMAL1 antibody was raised using the middle region of PNMAL1 corresponding to a region with amino acids APMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PNMAL1 Blocking Peptide, (ABIN936816), is also available for use as a blocking control in assays to test for specificity of this PNMAL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNMAL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PNMA-Like 1

Antigène: PNMA-Like 1 (PNMAL1)

Autre désignation: PNMAL1

Sujet: The function of PNMAL1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 48 kDa (MW of target protein)