RHOB anticorps (Middle Region)

N° du produit ABIN632603

Détail du produit anti-RHOB anticorps

Antigène: RHOB (Ras Homolog Gene Family, Member B (RHOB))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHOB est non-conjugé

Application: Western Blotting (WB)

Specificité: RHOB antibody was raised against the middle region of RHOB

Purification: Affinity purified

Immunogène: RHOB antibody was raised using the middle region of RHOB corresponding to a region with amino acids CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RHOB Blocking Peptide, catalog no. 33R-1769, is also available for use as a blocking control in assays to test for specificity of this RHOB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RHOB

Antigène: RHOB (Ras Homolog Gene Family, Member B (RHOB))

Autre désignation: RHOB (RHOB Produits)

Synonymes: anticorps ARH6, anticorps ARHB, anticorps MST081, anticorps MSTP081, anticorps RHOH6, anticorps AA017882, anticorps Arh6, anticorps Arhb, anticorps RHO, anticorps arha, anticorps rhoa, anticorps wu:fj42e08, anticorps zgc:92206, anticorps rhob, anticorps xrhob, anticorps ras homolog family member B, anticorps ras homolog gene family, member Ab, anticorps ras homolog family member B S homeolog, anticorps RHOB, anticorps Rhob, anticorps rhoab, anticorps rhob.S

Sujet: RHOB mediates apoptosis in neoplastically transformed cells after DNA damage.RHOB is not essential for development but affects cell adhesion and growth factor signaling in transformed cells.RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. RHOB is involved in intracellular protein trafficking of a number of proteins.RHOB targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes.

Poids moléculaire: 22 kDa (MW of target protein)