C3orf33 anticorps (Middle Region)

N° du produit ABIN632605

Détail du produit anti-C3orf33 anticorps

Antigène: C3orf33 (Chromosome 3 Open Reading Frame 33 (C3orf33))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C3orf33 est non-conjugé

Application: Western Blotting (WB)

Specificité: C3 orf33 antibody was raised against the middle region of C3 rf33

Purification: Affinity purified

Immunogène: C3 orf33 antibody was raised using the middle region of C3 rf33 corresponding to a region with amino acids NSALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C3orf33 Blocking Peptide, catalog no. 33R-6869, is also available for use as a blocking control in assays to test for specificity of this C3orf33 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C3orf33

Antigène: C3orf33 (Chromosome 3 Open Reading Frame 33 (C3orf33))

Autre désignation: C3orf33 (C3orf33 Produits)

Synonymes: anticorps AC3-33, anticorps MGC99235, anticorps chromosome 3 open reading frame 33, anticorps chromosome 3 open reading frame 33 L homeolog, anticorps RIKEN cDNA E130311K13 gene, anticorps C3orf33, anticorps c3orf33.L, anticorps E130311K13Rik

Sujet: The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 29 kDa (MW of target protein)