MAT2A anticorps (Middle Region)
-
- Antigène Voir toutes MAT2A Anticorps
- MAT2A (Methionine Adenosyltransferase II, alpha (MAT2A))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MAT2A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MAT2 A antibody was raised against the middle region of MAT2
- Purification
- Affinity purified
- Immunogène
- MAT2 A antibody was raised using the middle region of MAT2 corresponding to a region with amino acids LLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLK
- Top Product
- Discover our top product MAT2A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MAT2A Blocking Peptide, catalog no. 33R-5128, is also available for use as a blocking control in assays to test for specificity of this MAT2A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MAT2A (Methionine Adenosyltransferase II, alpha (MAT2A))
- Autre désignation
- MAT2A (MAT2A Produits)
- Synonymes
- anticorps MATA2, anticorps MATII, anticorps SAMS2, anticorps Sams2, anticorps D630045P18Rik, anticorps fd12a12, anticorps mat2a, anticorps si:ch73-340n8.1, anticorps wu:fb95e01, anticorps wu:fd12a12, anticorps m(2)21ab, anticorps MGC76253, anticorps MGC79598, anticorps zgc:110847, anticorps methionine adenosyltransferase 2A, anticorps methionine adenosyltransferase II, alpha, anticorps methionine adenosyltransferase II, alpha a, anticorps methionine adenosyltransferase II, alpha L homeolog, anticorps methionine adenosyltransferase II, alpha b, anticorps MAT2A, anticorps Mat2a, anticorps mat2aa, anticorps mat2a.L, anticorps mat2a, anticorps mat2ab
- Sujet
- MAT2A catalyzes the formation of S-adenosylmethionine from methionine and ATP.
- Poids moléculaire
- 44 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process
-