TMC8 anticorps (N-Term)

N° du produit ABIN632629

Détail du produit anti-TMC8 anticorps

Antigène: TMC8 (Transmembrane Channel-Like 8 (TMC8))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMC8 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMC8 antibody was raised against the N terminal of TMC8

Purification: Affinity purified

Immunogène: TMC8 antibody was raised using the N terminal of TMC8 corresponding to a region with amino acids PGPTLNLTLQCPGSRQSPPGVLRFHNQLWHVLTGRAFTNTYLFYGAYRVG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMC8 Blocking Peptide, catalog no. 33R-7123, is also available for use as a blocking control in assays to test for specificity of this TMC8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMC8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMC8

Antigène: TMC8 (Transmembrane Channel-Like 8 (TMC8))

Autre désignation: TMC8 (TMC8 Produits)

Synonymes: anticorps EV2, anticorps EVER2, anticorps EVIN2, anticorps Ever2, anticorps mFLJ00400, anticorps transmembrane channel like 8, anticorps transmembrane channel-like 8, anticorps transmembrane channel-like gene family 8, anticorps TMC8, anticorps Tmc8

Sujet: Epidermodysplasia verruciformis (EV) is an autosomal recessive dermatosis characterized by abnormal susceptibility to human papillomaviruses (HPVs) and a high rate of progression to squamous cell carcinoma on sun-exposed skin. EV is caused by mutations in either of two adjacent genes located on chromosome 17q25.3. Both of these genes encode integral membrane proteins that localize to the endoplasmic reticulum and are predicted to form transmembrane channels.

Poids moléculaire: 82 kDa (MW of target protein)