TOM1 anticorps

N° du produit ABIN632634

Détail du produit anti-TOM1 anticorps

Antigène: TOM1 (Target of Myb 1 (TOM1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TOM1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TOM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TOM1 Blocking Peptide, catalog no. 33R-8487, is also available for use as a blocking control in assays to test for specificity of this TOM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TOM1

Antigène: TOM1 (Target of Myb 1 (TOM1))

Autre désignation: TOM1 (TOM1 Produits)

Synonymes: anticorps TOM-1B, anticorps tom-1A, anticorps target of myb1 membrane trafficking protein, anticorps target of myb1 trafficking protein, anticorps TOM1, anticorps Tom1

Sujet: This gene was identified as a target of the v-myb oncogene. The encoded protein shares its N-terminal domain in common with proteins associated with vesicular trafficking at the endosome. It is recruited to the endosomes by its interaction with endofin. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 54 kDa (MW of target protein)