REM1 anticorps

N° du produit ABIN632639

Détail du produit anti-REM1 anticorps

Antigène: REM1 (RAS (RAD and GEM)-Like GTP-Binding 1 (REM1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp REM1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: REM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

REM1 Blocking Peptide, catalog no. 33R-8372, is also available for use as a blocking control in assays to test for specificity of this REM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur REM1

Antigène: REM1 (RAS (RAD and GEM)-Like GTP-Binding 1 (REM1))

Autre désignation: REM1 (REM1 Produits)

Synonymes: anticorps GD:REM, anticorps GES, anticorps E030011C07Rik, anticorps Rem, anticorps GEM, anticorps SI:zK76P14.3, anticorps horizin, anticorps rem, anticorps zgc:56144, anticorps RRAD and GEM like GTPase 1, anticorps rad and gem related GTP binding protein 1, anticorps RAS (RAD and GEM)-like GTP-binding 1, anticorps REM1, anticorps Rem1, anticorps rem1

Sujet: The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells.

Poids moléculaire: 33 kDa (MW of target protein)