DHFRL1 anticorps (Middle Region)
-
- Antigène Voir toutes DHFRL1 Anticorps
- DHFRL1 (Dihydrofolate Reductase-Like 1 (DHFRL1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DHFRL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DHFRL1 antibody was raised against the middle region of DHFRL1
- Purification
- Affinity purified
- Immunogène
- DHFRL1 antibody was raised using the middle region of DHFRL1 corresponding to a region with amino acids RINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSS
- Top Product
- Discover our top product DHFRL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DHFRL1 Blocking Peptide, catalog no. 33R-7973, is also available for use as a blocking control in assays to test for specificity of this DHFRL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHFRL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DHFRL1 (Dihydrofolate Reductase-Like 1 (DHFRL1))
- Autre désignation
- DHFRL1 (DHFRL1 Produits)
- Synonymes
- anticorps DHFRP4, anticorps dihydrofolate reductase 2, anticorps DHFR2
- Sujet
- DHFRL1 may play a role in folate metabolism.
- Poids moléculaire
- 21 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-