CNDP2 anticorps

N° du produit ABIN632658

Détail du produit anti-CNDP2 anticorps

Antigène: CNDP2 (CNDP Dipeptidase 2 (Metallopeptidase M20 Family) (CNDP2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CNDP2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CNDP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CNDP2 Blocking Peptide, catalog no. 33R-1325, is also available for use as a blocking control in assays to test for specificity of this CNDP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNDP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CNDP2

Antigène: CNDP2 (CNDP Dipeptidase 2 (Metallopeptidase M20 Family) (CNDP2))

Autre désignation: CNDP2 (CNDP2 Produits)

Synonymes: anticorps 0610010E05Rik, anticorps C76600, anticorps Cn2, anticorps Dip-2, anticorps Pep-1, anticorps Pep1, anticorps CN2, anticorps CPGL, anticorps HsT2298, anticorps PEPA, anticorps cn2, anticorps cpgl, anticorps darmin-r, anticorps CNDP2, anticorps zgc:92569, anticorps wu:fd20d11, anticorps wu:fe17f09, anticorps cndp2b, anticorps PEPC1, anticorps PEPCase, anticorps PPC1, anticorps PPEPC4, anticorps pepc, anticorps carnosine dipeptidase 2, anticorps CNDP dipeptidase 2 (metallopeptidase M20 family), anticorps CNDP dipeptidase 2 (metallopeptidase M20 family) S homeolog, anticorps CNDP dipeptidase 2 (metallopeptidase M20 family) L homeolog, anticorps phosphoenolpyruvate carboxylase 1, anticorps Cndp2, anticorps CNDP2, anticorps cndp2, anticorps cndp2.S, anticorps cndp2.L, anticorps pep1

Sujet: CNDP2, also known as tissue carnosinase and peptidase A (EC 3.4.13.18), is a nonspecific dipeptidase rather than a selective carnosinase.

Poids moléculaire: 53 kDa (MW of target protein)