CNDP2 anticorps
-
- Antigène Voir toutes CNDP2 Anticorps
- CNDP2 (CNDP Dipeptidase 2 (Metallopeptidase M20 Family) (CNDP2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CNDP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CNDP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVC
- Top Product
- Discover our top product CNDP2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CNDP2 Blocking Peptide, catalog no. 33R-1325, is also available for use as a blocking control in assays to test for specificity of this CNDP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNDP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CNDP2 (CNDP Dipeptidase 2 (Metallopeptidase M20 Family) (CNDP2))
- Autre désignation
- CNDP2 (CNDP2 Produits)
- Synonymes
- anticorps 0610010E05Rik, anticorps C76600, anticorps Cn2, anticorps Dip-2, anticorps Pep-1, anticorps Pep1, anticorps CN2, anticorps CPGL, anticorps HsT2298, anticorps PEPA, anticorps cn2, anticorps cpgl, anticorps darmin-r, anticorps CNDP2, anticorps zgc:92569, anticorps wu:fd20d11, anticorps wu:fe17f09, anticorps cndp2b, anticorps PEPC1, anticorps PEPCase, anticorps PPC1, anticorps PPEPC4, anticorps pepc, anticorps carnosine dipeptidase 2, anticorps CNDP dipeptidase 2 (metallopeptidase M20 family), anticorps CNDP dipeptidase 2 (metallopeptidase M20 family) S homeolog, anticorps CNDP dipeptidase 2 (metallopeptidase M20 family) L homeolog, anticorps phosphoenolpyruvate carboxylase 1, anticorps Cndp2, anticorps CNDP2, anticorps cndp2, anticorps cndp2.S, anticorps cndp2.L, anticorps pep1
- Sujet
- CNDP2, also known as tissue carnosinase and peptidase A (EC 3.4.13.18), is a nonspecific dipeptidase rather than a selective carnosinase.
- Poids moléculaire
- 53 kDa (MW of target protein)
-