C1orf131 anticorps (Middle Region)

N° du produit ABIN632663

Détail du produit anti-C1orf131 anticorps

Antigène: C1orf131 (Chromosome 1 Open Reading Frame 131 (C1orf131))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C1orf131 est non-conjugé

Application: Western Blotting (WB)

Specificité: C1 ORF131 antibody was raised against the middle region of C1 rf131

Purification: Affinity purified

Immunogène: C1 ORF131 antibody was raised using the middle region of C1 rf131 corresponding to a region with amino acids TGPEILAAAVPPSSLKNNREQVEVVEFHSNKKRKLTPDHNKNTKQANPSV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1ORF131 Blocking Peptide, catalog no. 33R-9091, is also available for use as a blocking control in assays to test for specificity of this C1ORF131 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF131 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C1orf131

Antigène: C1orf131 (Chromosome 1 Open Reading Frame 131 (C1orf131))

Autre désignation: C1ORF131 (C1orf131 Produits)

Synonymes: anticorps C3H1orf131, anticorps 3110004G14Rik, anticorps Ayu21-55, anticorps Gt(pU21)55Imeg, anticorps GtAyu21-55, anticorps chromosome 1 open reading frame 131, anticorps chromosome 3 open reading frame, human C1orf131, anticorps RIKEN cDNA 2810004N23 gene, anticorps similar to RIKEN cDNA 0610039J04, anticorps C1orf131, anticorps C3H1ORF131, anticorps c1orf131, anticorps 2810004N23Rik, anticorps RGD1562218

Sujet: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 32 kDa (MW of target protein)