PPP1R27 anticorps (Middle Region)
-
- Antigène Voir toutes PPP1R27 Anticorps
- PPP1R27 (Protein Phosphatase 1, Regulatory Subunit 27 (PPP1R27))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPP1R27 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DYSFIP1 antibody was raised against the middle region of DYSFIP1
- Purification
- Affinity purified
- Immunogène
- DYSFIP1 antibody was raised using the middle region of DYSFIP1 corresponding to a region with amino acids CSDGYPDIARYLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD
- Top Product
- Discover our top product PPP1R27 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DYSFIP1 Blocking Peptide, catalog no. 33R-1805, is also available for use as a blocking control in assays to test for specificity of this DYSFIP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYSFIP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PPP1R27 (Protein Phosphatase 1, Regulatory Subunit 27 (PPP1R27))
- Autre désignation
- DYSFIP1 (PPP1R27 Produits)
- Synonymes
- anticorps DYSFIP1, anticorps 1110033I14Rik, anticorps Dysfip1, anticorps toonin, anticorps RGD1308861, anticorps protein phosphatase 1 regulatory subunit 27, anticorps protein phosphatase 1, regulatory subunit 27, anticorps PPP1R27, anticorps Ppp1r27
- Sujet
- The function of DYSFIP1 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 17 kDa (MW of target protein)
-