CELA1 anticorps (N-Term)

N° du produit ABIN632696

Détail du produit anti-CELA1 anticorps

Antigène: CELA1 (Chymotrypsin-Like Elastase Family, Member 1 (CELA1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CELA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Elastase 1 antibody (Pancreatic) was raised against the N terminal of ELA1

Purification: Affinity purified

Immunogène: Elastase 1 antibody (Pancreatic) was raised using the N terminal of ELA1 corresponding to a region with amino acids LVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Elastase 1 Blocking Peptide (Pancreatic), catalog no. 33R-5528, is also available for use as a blocking control in assays to test for specificity of this Elastase 1 antibody (Pancreatic)

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CELA1

Antigène: CELA1 (Chymotrypsin-Like Elastase Family, Member 1 (CELA1))

Autre désignation: Elastase 1 (CELA1 Produits)

Synonymes: anticorps ELA1, anticorps 1810009A17Rik, anticorps 1810062B19Rik, anticorps Ela-1, anticorps Ela1, anticorps PC-TsF, anticorps ela1, anticorps ELS1, anticorps Elastase-1, anticorps ELAI1, anticorps RATELAI1, anticorps chymotrypsin like elastase family member 1, anticorps chymotrypsin-like elastase family, member 1, anticorps CELA1, anticorps Cela1, anticorps cela1

Sujet: Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 (ELA1) expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas is actually referring to elastase 2A.

Poids moléculaire: 28 kDa (MW of target protein)