Acap3 anticorps (N-Term)
-
- Antigène Voir toutes Acap3 Anticorps
- Acap3 (ArfGAP with Coiled-Coil, Ankyrin Repeat and PH Domains 3 (Acap3))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Acap3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CENTB5 antibody was raised against the N terminal of CENTB5
- Purification
- Affinity purified
- Immunogène
- CENTB5 antibody was raised using the N terminal of CENTB5 corresponding to a region with amino acids LQSFVKEDVRKFKETKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGA
- Top Product
- Discover our top product Acap3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CENTB5 Blocking Peptide, catalog no. 33R-5340, is also available for use as a blocking control in assays to test for specificity of this CENTB5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENTB5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Acap3 (ArfGAP with Coiled-Coil, Ankyrin Repeat and PH Domains 3 (Acap3))
- Autre désignation
- CENTB5 (Acap3 Produits)
- Synonymes
- anticorps CENTB5, anticorps Centb5, anticorps Kiaa1716-hp, anticorps mKIAA1716, anticorps ArfGAP with coiled-coil, ankyrin repeat and PH domains 3, anticorps arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3, anticorps ACAP3, anticorps LOC100568277, anticorps Acap3
- Sujet
- CENTB5 is a GTPase-activating protein for the ADP ribosylation factor family.
- Poids moléculaire
- 85 kDa (MW of target protein)
-