SERPINB1 anticorps

N° du produit ABIN632703

Détail du produit anti-SERPINB1 anticorps

Antigène: SERPINB1 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 1 (SERPINB1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SERPINB1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SERPINB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SERPINB1 Blocking Peptide, catalog no. 33R-8251, is also available for use as a blocking control in assays to test for specificity of this SERPINB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SERPINB1

Antigène: SERPINB1 (serpin Peptidase Inhibitor, Clade B (Ovalbumin), Member 1 (SERPINB1))

Autre désignation: SERPINB1 (SERPINB1 Produits)

Synonymes: anticorps ELANH2, anticorps zgc:91981, anticorps si:dkey-177p2.11, anticorps si:dkey-177p2.12, anticorps EI, anticorps LEI, anticorps M/NEI, anticorps MNEI, anticorps PI-2, anticorps PI2, anticorps elanh2, anticorps lei, anticorps m/nei, anticorps mnei, anticorps pi2, anticorps serpin peptidase inhibitor, clade B (ovalbumin), member 1, anticorps serpin family B member 1, anticorps serpin family B member 1 L homeolog, anticorps SERPINB1, anticorps serpinb1, anticorps serpinb1.L

Sujet: SERPINB1 regulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase, chymotrypsin, and kallikrein-3.

Poids moléculaire: 43 kDa (MW of target protein)