C11ORF74 anticorps (Middle Region)

N° du produit ABIN632721

Détail du produit anti-C11ORF74 anticorps

Antigène: C11ORF74 (Chromosome 11 Open Reading Frame 74 (C11ORF74))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C11ORF74 est non-conjugé

Application: Western Blotting (WB)

Specificité: C11 ORF74 antibody was raised against the middle region of C11 rf74

Purification: Affinity purified

Immunogène: C11 ORF74 antibody was raised using the middle region of C11 rf74 corresponding to a region with amino acids VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSCD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C11ORF74 Blocking Peptide, catalog no. 33R-9749, is also available for use as a blocking control in assays to test for specificity of this C11ORF74 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF74 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C11ORF74

Antigène: C11ORF74 (Chromosome 11 Open Reading Frame 74 (C11ORF74))

Autre désignation: C11ORF74 (C11ORF74 Produits)

Synonymes: anticorps HEPIS, anticorps chromosome 11 open reading frame 74, anticorps chromosome 5 C11orf74 homolog, anticorps C11orf74, anticorps C5H11orf74, anticorps c11orf74

Sujet: The function of C11orf74 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 25 kDa (MW of target protein)