CCDC151 anticorps (Middle Region)

N° du produit ABIN632726

Détail du produit anti-CCDC151 anticorps

Antigène: CCDC151 (Coiled-Coil Domain Containing 151 (CCDC151))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC151 est non-conjugé

Application: Western Blotting (WB)

Specificité: MGC20983 antibody was raised against the middle region of Mgc20983

Purification: Affinity purified

Immunogène: MGC20983 antibody was raised using the middle region of Mgc20983 corresponding to a region with amino acids IALPLATSKDKFFDEESEEEDNEVVTRASLKIRSQKLIESHKKHRRSRRS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MGC20983 Blocking Peptide, catalog no. 33R-3894, is also available for use as a blocking control in assays to test for specificity of this MGC20983 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC20983 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCDC151

Antigène: CCDC151 (Coiled-Coil Domain Containing 151 (CCDC151))

Autre désignation: MGC20983 (CCDC151 Produits)

Synonymes: anticorps AI644415, anticorps C330001K17Rik, anticorps coiled-coil domain containing 151, anticorps CCDC151, anticorps Ccdc151

Sujet: The function of the MGC20983 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 69 kDa (MW of target protein)