MLKL anticorps (N-Term)

N° du produit ABIN632746

Détail du produit anti-MLKL anticorps

Antigène: MLKL (Mixed Lineage Kinase Domain-Like (MLKL))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MLKL est non-conjugé

Application: Western Blotting (WB)

Specificité: MLKL antibody was raised against the N terminal of MLKL

Purification: Affinity purified

Immunogène: MLKL antibody was raised using the N terminal of MLKL corresponding to a region with amino acids DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MLKL Blocking Peptide, catalog no. 33R-2230, is also available for use as a blocking control in assays to test for specificity of this MLKL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLKL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MLKL

Antigène: MLKL (Mixed Lineage Kinase Domain-Like (MLKL))

Autre désignation: MLKL (MLKL Produits)

Synonymes: anticorps MLKL, anticorps 9130019I15Rik, anticorps mixed lineage kinase domain like pseudokinase, anticorps mixed lineage kinase domain-like, anticorps MLKL, anticorps mlkl, anticorps Mlkl

Sujet: The function of MLKL protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 54 kDa (MW of target protein)