RAB3IP anticorps

N° du produit ABIN632769

Détail du produit anti-RAB3IP anticorps

Antigène: RAB3IP (RAB3A Interacting Protein (Rabin3) (RAB3IP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB3IP est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RAB3 IP antibody was raised using a synthetic peptide corresponding to a region with amino acids APCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB3IP Blocking Peptide, catalog no. 33R-1417, is also available for use as a blocking control in assays to test for specificity of this RAB3IP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB3IP

Antigène: RAB3IP (RAB3A Interacting Protein (Rabin3) (RAB3IP))

Autre désignation: RAB3IP (RAB3IP Produits)

Synonymes: anticorps rabin3, anticorps gtpat12, anticorps MGC64583, anticorps MGC75737, anticorps MGC82752, anticorps zgc:110270, anticorps DKFZp469A0532, anticorps DKFZp469O1131, anticorps RABIN3, anticorps B230311A06, anticorps Gtpat12, anticorps Rabin3, anticorps RAB3A interacting protein L homeolog, anticorps RAB3A interacting protein, anticorps RAB3A interacting protein (rabin3), anticorps rab3ip.L, anticorps rab3ip, anticorps RAB3IP, anticorps Rab3ip

Sujet: The function of RAB3A protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 53 kDa (MW of target protein)