DCUN1D4 anticorps
-
- Antigène Voir toutes DCUN1D4 Anticorps
- DCUN1D4 (DCN1, Defective in Cullin Neddylation 1, Domain Containing 4 (DCUN1D4))
-
Reactivité
- Souris, Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DCUN1D4 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DCUN1 D4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPL
- Top Product
- Discover our top product DCUN1D4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DCUN1D4 Blocking Peptide, catalog no. 33R-10181, is also available for use as a blocking control in assays to test for specificity of this DCUN1D4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCUN0 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DCUN1D4 (DCN1, Defective in Cullin Neddylation 1, Domain Containing 4 (DCUN1D4))
- Autre désignation
- DCUN1D4 (DCUN1D4 Produits)
- Synonymes
- anticorps RGD1310422, anticorps si:ch211-14g4.1, anticorps AI836376, anticorps DCN1-like protein 4, anticorps defective in cullin neddylation 1 domain containing 4, anticorps DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae), anticorps LOC100282616, anticorps LOC100283419, anticorps dcnl4, anticorps DCUN1D4, anticorps Dcun1d4, anticorps dcun1d4
- Sujet
- DCUN1D4 contains 1 DCUN1 domain. The exact function of DCUN1D4 remains unknown.
- Poids moléculaire
- 34 kDa (MW of target protein)
-