CHORDC1 anticorps

N° du produit ABIN632798

Détail du produit anti-CHORDC1 anticorps

Antigène: CHORDC1 (Cysteine and Histidine-Rich Domain (CHORD)-Containing 1 (CHORDC1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHORDC1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CHORDC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHORDC1 Blocking Peptide, catalog no. 33R-8501, is also available for use as a blocking control in assays to test for specificity of this CHORDC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHORDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHORDC1

Antigène: CHORDC1 (Cysteine and Histidine-Rich Domain (CHORD)-Containing 1 (CHORDC1))

Autre désignation: CHORDC1 (CHORDC1 Produits)

Synonymes: anticorps CHP1, anticorps CHP-1, anticorps MGC89160, anticorps NV16801, anticorps Chp-1, anticorps Morgana, anticorps 1110001O09Rik, anticorps AA409036, anticorps morgana, anticorps zgc:63894, anticorps cysteine and histidine rich domain containing 1, anticorps cysteine and histidine-rich domain-containing protein, anticorps cysteine and histidine rich domain containing 1 S homeolog, anticorps cysteine and histidine-rich domain (CHORD)-containing 1, anticorps cysteine and histidine-rich domain (CHORD)-containing, zinc-binding protein 1, anticorps cysteine and histidine-rich domain (CHORD) containing 1b, anticorps CHORDC1, anticorps Chordc1, anticorps LOC412067, anticorps chordc1.S, anticorps chordc1, anticorps chordc1b

Sujet: CHORDC1 may be play a role in the regulation of NOD1 via its interaction with HSP90AA1.

Poids moléculaire: 37 kDa (MW of target protein)