SMG5 anticorps
-
- Antigène Voir toutes SMG5 Anticorps
- SMG5 (Smg-5 Homolog, Nonsense Mediated mRNA Decay Factor (SMG5))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SMG5 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SMG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKP
- Top Product
- Discover our top product SMG5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SMG5 Blocking Peptide, catalog no. 33R-6479, is also available for use as a blocking control in assays to test for specificity of this SMG5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMG5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SMG5 (Smg-5 Homolog, Nonsense Mediated mRNA Decay Factor (SMG5))
- Autre désignation
- SMG5 (SMG5 Produits)
- Synonymes
- anticorps BC024683, anticorps mKIAA1089, anticorps EST1B, anticorps LPTS-RP1, anticorps LPTSRP1, anticorps SMG-5, anticorps SMG5, nonsense mediated mRNA decay factor, anticorps Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans), anticorps SMG5 nonsense mediated mRNA decay factor, anticorps SMG5, anticorps Smg5
- Sujet
- SMG5 plays a role in nonsense-mediated mRNA decay. SMG5 does not have RNase activity by itself. SMG5 promotes dephosphorylation of RENT1. SMG5 is necessary for TERT activity.
- Poids moléculaire
- 114 kDa (MW of target protein)
-