SMG5 anticorps

N° du produit ABIN632808

Cet anticorps anti-SMG5 Polyclonal Lapin (ABIN632808) détecte spécifiquement SMG5 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour SMG5 anticorps (ABIN632808)

Antigène: SMG5 (Smg-5 Homolog, Nonsense Mediated mRNA Decay Factor (SMG5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SMG5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SMG5 anticorps

Purification: Affinity purified

Immunogène: SMG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SMG5 Blocking Peptide, (ABIN5616302), is also available for use as a blocking control in assays to test for specificity of this SMG5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMG5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SMG5

Antigène: SMG5 (Smg-5 Homolog, Nonsense Mediated mRNA Decay Factor (SMG5))

Autre désignation: SMG5

Sujet: SMG5 plays a role in nonsense-mediated mRNA decay. SMG5 does not have RNase activity by itself. SMG5 promotes dephosphorylation of RENT1. SMG5 is necessary for TERT activity.

Poids moléculaire: 114 kDa (MW of target protein)