LRRC57 anticorps (Middle Region)
-
- Antigène Voir toutes LRRC57 Anticorps
- LRRC57 (Leucine Rich Repeat Containing 57 (LRRC57))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LRRC57 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LRRC57 antibody was raised against the middle region of LRRC57
- Purification
- Affinity purified
- Immunogène
- LRRC57 antibody was raised using the middle region of LRRC57 corresponding to a region with amino acids NNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQL
- Top Product
- Discover our top product LRRC57 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LRRC57 Blocking Peptide, catalog no. 33R-6807, is also available for use as a blocking control in assays to test for specificity of this LRRC57 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC57 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LRRC57 (Leucine Rich Repeat Containing 57 (LRRC57))
- Autre désignation
- LRRC57 (LRRC57 Produits)
- Synonymes
- anticorps zgc:92240, anticorps 2810002D13Rik, anticorps AA407405, anticorps RGD1307128, anticorps leucine rich repeat containing 57, anticorps leucine rich repeat containing 57 L homeolog, anticorps lrrc57, anticorps lrrc57.L, anticorps LRRC57, anticorps Lrrc57
- Sujet
- LRRC57 is a member of the leucine-rich repeat family of proteins, which are known to be involved in protein-protein interactions.
- Poids moléculaire
- 27 kDa (MW of target protein)
-