ZCCHC13 anticorps (Middle Region)
-
- Antigène Voir toutes ZCCHC13 Anticorps
- ZCCHC13 (Zinc Finger, C3HC-Type Containing 13 (ZCCHC13))
-
Épitope
- Middle Region
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ZCCHC13 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ZCCHC13 antibody was raised against the middle region of ZCCHC13
- Purification
- Affinity purified
- Immunogène
- ZCCHC13 antibody was raised using the middle region of ZCCHC13 corresponding to a region with amino acids GKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMS
- Top Product
- Discover our top product ZCCHC13 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ZCCHC13 Blocking Peptide, catalog no. 33R-3370, is also available for use as a blocking control in assays to test for specificity of this ZCCHC13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZCCHC13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ZCCHC13 (Zinc Finger, C3HC-Type Containing 13 (ZCCHC13))
- Autre désignation
- ZCCHC13 (ZCCHC13 Produits)
- Synonymes
- anticorps CNBP2, anticorps ZNF9L, anticorps zinc finger CCHC-type containing 13, anticorps ZCCHC13
- Sujet
- The function of ZCCHC13 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 18 kDa (MW of target protein)
-