ZCCHC13 anticorps (Middle Region)

N° du produit ABIN632852

Détail du produit anti-ZCCHC13 anticorps

Antigène: ZCCHC13 (Zinc Finger, C3HC-Type Containing 13 (ZCCHC13))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZCCHC13 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZCCHC13 antibody was raised against the middle region of ZCCHC13

Purification: Affinity purified

Immunogène: ZCCHC13 antibody was raised using the middle region of ZCCHC13 corresponding to a region with amino acids GKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZCCHC13 Blocking Peptide, catalog no. 33R-3370, is also available for use as a blocking control in assays to test for specificity of this ZCCHC13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZCCHC13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZCCHC13

Antigène: ZCCHC13 (Zinc Finger, C3HC-Type Containing 13 (ZCCHC13))

Autre désignation: ZCCHC13 (ZCCHC13 Produits)

Synonymes: anticorps CNBP2, anticorps ZNF9L, anticorps zinc finger CCHC-type containing 13, anticorps ZCCHC13

Sujet: The function of ZCCHC13 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 18 kDa (MW of target protein)