PEPD anticorps (Middle Region)

N° du produit ABIN632867

Détail du produit anti-PEPD anticorps

Antigène: PEPD (Peptidase D (PEPD))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PEPD est non-conjugé

Application: Western Blotting (WB)

Specificité: Peptidase D antibody was raised against the middle region of PEPD

Purification: Affinity purified

Immunogène: Peptidase D antibody was raised using the middle region of PEPD corresponding to a region with amino acids LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Peptidase D Blocking Peptide, catalog no. 33R-4964, is also available for use as a blocking control in assays to test for specificity of this Peptidase D antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEPD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PEPD

Antigène: PEPD (Peptidase D (PEPD))

Autre désignation: Peptidase D (PEPD Produits)

Synonymes: anticorps MGC89151, anticorps DDBDRAFT_0190220, anticorps DDBDRAFT_0266378, anticorps DDB_0190220, anticorps DDB_0266378, anticorps PROLIDASE, anticorps cb1000, anticorps fj78g11, anticorps wu:fj78g11, anticorps prolidase, anticorps Pep-4, anticorps Pep4, anticorps peptidase D, anticorps peptidase D L homeolog, anticorps pepd, anticorps pepD, anticorps PEPD, anticorps pepd.L, anticorps Pepd

Sujet: Xaa-Pro dipeptidase is a cytosolic dipeptidase that hydrolyzes dipeptides with proline or hydroxyproline at the carboxy terminus (but not Pro-Pro). It is important in collagen metabolism because of the high levels of iminoacids.

Poids moléculaire: 54 kDa (MW of target protein)