C18orf32 anticorps (Middle Region)

N° du produit ABIN632881

Détail du produit anti-C18orf32 anticorps

Antigène: C18orf32 (Chromosome 18 Open Reading Frame 32 (C18orf32))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C18orf32 est non-conjugé

Application: Western Blotting (WB)

Specificité: C18 ORF32 antibody was raised against the middle region of C18 rf32

Purification: Affinity purified

Immunogène: C18 ORF32 antibody was raised using the middle region of C18 rf32 corresponding to a region with amino acids PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C18ORF32 Blocking Peptide, catalog no. 33R-7213, is also available for use as a blocking control in assays to test for specificity of this C18ORF32 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF32 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C18orf32

Antigène: C18orf32 (Chromosome 18 Open Reading Frame 32 (C18orf32))

Autre désignation: C18ORF32 (C18orf32 Produits)

Synonymes: anticorps chromosome 18 open reading frame 32, anticorps chromosome Z open reading frame, human C18orf32, anticorps C18orf32, anticorps CZH18ORF32, anticorps c18orf32

Sujet: The C18ORF32 protein may activate the NF-kappa-B signaling pathway.

Poids moléculaire: 9 kDa (MW of target protein)