C18orf32 anticorps (Middle Region)
-
- Antigène Voir toutes C18orf32 Anticorps
- C18orf32 (Chromosome 18 Open Reading Frame 32 (C18orf32))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C18orf32 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C18 ORF32 antibody was raised against the middle region of C18 rf32
- Purification
- Affinity purified
- Immunogène
- C18 ORF32 antibody was raised using the middle region of C18 rf32 corresponding to a region with amino acids PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK
- Top Product
- Discover our top product C18orf32 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C18ORF32 Blocking Peptide, catalog no. 33R-7213, is also available for use as a blocking control in assays to test for specificity of this C18ORF32 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF32 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C18orf32 (Chromosome 18 Open Reading Frame 32 (C18orf32))
- Autre désignation
- C18ORF32 (C18orf32 Produits)
- Synonymes
- anticorps chromosome 18 open reading frame 32, anticorps chromosome Z open reading frame, human C18orf32, anticorps C18orf32, anticorps CZH18ORF32, anticorps c18orf32
- Sujet
- The C18ORF32 protein may activate the NF-kappa-B signaling pathway.
- Poids moléculaire
- 9 kDa (MW of target protein)
-