MAGEB2 anticorps (N-Term)

N° du produit ABIN632892

Cet anticorps anti-MAGEB2 Polyclonal Lapin (ABIN632892) détecte spécifiquement MAGEB2 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour MAGEB2 anticorps (N-Term) (ABIN632892)

Antigène: MAGEB2 (Melanoma Antigen Family B, 2 (MAGEB2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAGEB2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MAGEB2 anticorps

Épitope: N-Term

Specificité: MAGEB2 antibody was raised against the N terminal of MAGEB2

Purification: Affinity purified

Immunogène: MAGEB2 antibody was raised using the N terminal of MAGEB2 corresponding to a region with amino acids MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAGEB2 Blocking Peptide, (ABIN5614635), is also available for use as a blocking control in assays to test for specificity of this MAGEB2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAGEB2

Antigène: MAGEB2 (Melanoma Antigen Family B, 2 (MAGEB2))

Autre désignation: MAGEB2

Sujet: This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other.

Poids moléculaire: 35 kDa (MW of target protein)