MAGEB2 anticorps (N-Term)
-
- Antigène Voir toutes MAGEB2 Anticorps
- MAGEB2 (Melanoma Antigen Family B, 2 (MAGEB2))
-
Épitope
- N-Term
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MAGEB2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MAGEB2 antibody was raised against the N terminal of MAGEB2
- Purification
- Affinity purified
- Immunogène
- MAGEB2 antibody was raised using the N terminal of MAGEB2 corresponding to a region with amino acids MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAA
- Top Product
- Discover our top product MAGEB2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MAGEB2 Blocking Peptide, catalog no. 33R-6302, is also available for use as a blocking control in assays to test for specificity of this MAGEB2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MAGEB2 (Melanoma Antigen Family B, 2 (MAGEB2))
- Autre désignation
- MAGEB2 (MAGEB2 Produits)
- Synonymes
- anticorps MAGEB2, anticorps CT3.2, anticorps DAM6, anticorps MAGE-XP-2, anticorps MAGE family member B2, anticorps MAGEB2
- Sujet
- This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other.
- Poids moléculaire
- 35 kDa (MW of target protein)
-