SMU1 anticorps

N° du produit ABIN632943

Détail du produit anti-SMU1 anticorps

Antigène: SMU1 (Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (SMU1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SMU1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SMU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQALAGEVSVV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SMU1 Blocking Peptide, catalog no. 33R-4615, is also available for use as a blocking control in assays to test for specificity of this SMU1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMU1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SMU1

Antigène: SMU1 (Smu-1 Suppressor of Mec-8 and Unc-52 Homolog (SMU1))

Autre désignation: SMU1 (SMU1 Produits)

Synonymes: anticorps SMU1, anticorps BWD, anticorps RP11-54K16.3, anticorps SMU-1, anticorps fSAP57, anticorps 2600001O03Rik, anticorps 2610203K23Rik, anticorps AB044414, anticorps AI845086, anticorps AW556129, anticorps Bwd, anticorps Smu-1, anticorps zgc:56147, anticorps SMU1, DNA replication regulator and spliceosomal factor, anticorps WD40 repeat-containing protein SMU1, anticorps smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans), anticorps DNA replication regulator and spliceosomal factor, anticorps SMU1, DNA replication regulator and spliceosomal factor a, anticorps SMU1, anticorps LOC100180093, anticorps Smu1, anticorps smu1a

Sujet: SMU1 acts a s a suppressor of mec-8 and unc-52 homolog.

Poids moléculaire: 57 kDa (MW of target protein)