ACTR10 anticorps
-
- Antigène Voir toutes ACTR10 Anticorps
- ACTR10 (Actin-Related Protein 10 Homolog (ACTR10))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACTR10 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ACTR10 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKAL
- Top Product
- Discover our top product ACTR10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACTR10 Blocking Peptide, catalog no. 33R-8598, is also available for use as a blocking control in assays to test for specificity of this ACTR10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACTR10 (Actin-Related Protein 10 Homolog (ACTR10))
- Autre désignation
- ACTR10 (ACTR10 Produits)
- Synonymes
- anticorps ACTR11, anticorps Arp11, anticorps HARP11, anticorps Actr11, anticorps actin related protein 10 homolog, anticorps actin-related protein 10 homolog, anticorps ARP10 actin-related protein 10, anticorps ACTR10, anticorps Actr10
- Sujet
- ACTR10 may be involved in protein binding.
- Poids moléculaire
- 46 kDa (MW of target protein)
-