ACTR10 anticorps

N° du produit ABIN632949

Détail du produit anti-ACTR10 anticorps

Antigène: ACTR10 (Actin-Related Protein 10 Homolog (ACTR10))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACTR10 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ACTR10 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACTR10 Blocking Peptide, catalog no. 33R-8598, is also available for use as a blocking control in assays to test for specificity of this ACTR10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACTR10

Antigène: ACTR10 (Actin-Related Protein 10 Homolog (ACTR10))

Autre désignation: ACTR10 (ACTR10 Produits)

Synonymes: anticorps ACTR11, anticorps Arp11, anticorps HARP11, anticorps Actr11, anticorps actin related protein 10 homolog, anticorps actin-related protein 10 homolog, anticorps ARP10 actin-related protein 10, anticorps ACTR10, anticorps Actr10

Sujet: ACTR10 may be involved in protein binding.

Poids moléculaire: 46 kDa (MW of target protein)