FAM36A anticorps (Middle Region)

N° du produit ABIN632967

Détail du produit anti-FAM36A anticorps

Antigène: FAM36A (Family with Sequence Similarity 36, Member A (FAM36A))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM36A est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM36 A antibody was raised against the middle region of FAM36

Purification: Affinity purified

Immunogène: FAM36 A antibody was raised using the middle region of FAM36 corresponding to a region with amino acids LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM36A Blocking Peptide, catalog no. 33R-4967, is also available for use as a blocking control in assays to test for specificity of this FAM36A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM36A

Antigène: FAM36A (Family with Sequence Similarity 36, Member A (FAM36A))

Autre désignation: FAM36A (FAM36A Produits)

Synonymes: anticorps FAM36A, anticorps 2310005N03Rik, anticorps Fam36a, anticorps RGD1309105, anticorps cox20, anticorps fam36a, anticorps COX20, cytochrome c oxidase assembly factor, anticorps COX20 Cox2 chaperone, anticorps COX20 cytochrome C oxidase assembly factor, anticorps COX20 cytochrome c oxidase assembly factor L homeolog, anticorps COX20, anticorps Cox20, anticorps cox20.L

Sujet: FAM36A is a multi-pass membrane protein. It belongs to the FAM36 family. The exact function of FAM36A remains unknown.

Poids moléculaire: 13 kDa (MW of target protein)