TTC35 anticorps (Middle Region)

N° du produit ABIN632993

Détail du produit anti-TTC35 anticorps

Antigène: TTC35 (Tetratricopeptide Repeat Domain 35 (TTC35))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TTC35 est non-conjugé

Application: Western Blotting (WB)

Specificité: TTC35 antibody was raised against the middle region of TTC35

Purification: Affinity purified

Immunogène: TTC35 antibody was raised using the middle region of TTC35 corresponding to a region with amino acids IQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TTC35 Blocking Peptide, catalog no. 33R-4119, is also available for use as a blocking control in assays to test for specificity of this TTC35 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TTC35

Antigène: TTC35 (Tetratricopeptide Repeat Domain 35 (TTC35))

Autre désignation: TTC35 (TTC35 Produits)

Synonymes: anticorps TTC35, anticorps KIAA0103, anticorps kiaa0103, anticorps ttc35, anticorps 4921531G14Rik, anticorps AV060620, anticorps AW209495, anticorps Ttc35, anticorps RGD1310430, anticorps emc2-b, anticorps ttc35-b, anticorps zgc:73154, anticorps zgc:86891, anticorps ER membrane protein complex subunit 2, anticorps tetratricopeptide repeat domain 35, anticorps ER membrane protein complex subunit 2 S homeolog, anticorps EMC2, anticorps emc2, anticorps CC1G_12481, anticorps Ttc35, anticorps Emc2, anticorps emc2.S

Sujet: The function of TTC35 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 35 kDa (MW of target protein)