ARC (Middle Region) anticorps

N° du produit ABIN632995

Détail du produit

Antigène: ARC

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: ARC antibody was raised against the middle region of ARC

Purification: Affinity purified

Immunogène: ARC antibody was raised using the middle region of ARC corresponding to a region with amino acids ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARC Blocking Peptide, catalog no. 33R-2534, is also available for use as a blocking control in assays to test for specificity of this ARC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: ARC

Synonymes: anticorps activity regulated cytoskeleton associated protein, anticorps Arc

Sujet: ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity. The protein is also required for homeostatic synaptic scaling of AMPA receptors.

Poids moléculaire: 45 kDa (MW of target protein)