PEF1 anticorps (Middle Region)

N° du produit ABIN633001

Détail du produit anti-PEF1 anticorps

Antigène: PEF1 (Penta-EF-Hand Domain Containing 1 (PEF1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PEF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PEF1 antibody was raised against the middle region of PEF1

Purification: Affinity purified

Immunogène: PEF1 antibody was raised using the middle region of PEF1 corresponding to a region with amino acids WKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PEF1 Blocking Peptide, catalog no. 33R-9960, is also available for use as a blocking control in assays to test for specificity of this PEF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PEF1

Antigène: PEF1 (Penta-EF-Hand Domain Containing 1 (PEF1))

Autre désignation: PEF1 (PEF1 Produits)

Synonymes: anticorps 2600002E23Rik, anticorps Peflin, anticorps ABP32, anticorps PEF1A, anticorps zgc:100787, anticorps penta-EF hand domain containing 1, anticorps penta-EF-hand domain containing 1, anticorps penta-EF-hand domain containing 1 L homeolog, anticorps Pef1, anticorps PEF1, anticorps pef1, anticorps pef1.L

Sujet: PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit, sorcin, grancalcin, and ALG2.PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit.

Poids moléculaire: 31 kDa (MW of target protein)