SDR16C5 anticorps (Middle Region)

N° du produit ABIN633013

Détail du produit anti-SDR16C5 anticorps

Antigène: SDR16C5 (RDHE2) (Epidermal Retinal Dehydrogenase 2 (RDHE2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SDR16C5 est non-conjugé

Application: Western Blotting (WB)

Specificité: RDHE2 antibody was raised against the middle region of RDHE2

Purification: Affinity purified

Immunogène: RDHE2 antibody was raised using the middle region of RDHE2 corresponding to a region with amino acids AGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RDHE2 Blocking Peptide, catalog no. 33R-1208, is also available for use as a blocking control in assays to test for specificity of this RDHE2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDHE2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SDR16C5

Antigène: SDR16C5 (RDHE2) (Epidermal Retinal Dehydrogenase 2 (RDHE2))

Autre désignation: RDHE2 (RDHE2 Produits)

Synonymes: anticorps RDH2, anticorps RDH-E2, anticorps RDHE2, anticorps Rdhe2, anticorps Scdr9, anticorps RGD1565999, anticorps rdhe2, anticorps sdr16c5, anticorps short chain dehydrogenase/reductase family 16C member 5, anticorps short chain dehydrogenase/reductase family 16C, member 5, anticorps short chain dehydrogenase/reductase family 16C member 5 L homeolog, anticorps SDR16C5, anticorps Sdr16c5, anticorps sdr16c5.L

Sujet: The specific function of RDHE2 is not yet known.

Poids moléculaire: 34 kDa (MW of target protein)