SDR16C5 anticorps (Middle Region)
-
- Antigène Voir toutes SDR16C5 (RDHE2) Anticorps
- SDR16C5 (RDHE2) (Epidermal Retinal Dehydrogenase 2 (RDHE2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SDR16C5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RDHE2 antibody was raised against the middle region of RDHE2
- Purification
- Affinity purified
- Immunogène
- RDHE2 antibody was raised using the middle region of RDHE2 corresponding to a region with amino acids AGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKT
- Top Product
- Discover our top product RDHE2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RDHE2 Blocking Peptide, catalog no. 33R-1208, is also available for use as a blocking control in assays to test for specificity of this RDHE2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDHE2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SDR16C5 (RDHE2) (Epidermal Retinal Dehydrogenase 2 (RDHE2))
- Autre désignation
- RDHE2 (RDHE2 Produits)
- Synonymes
- anticorps RDH2, anticorps RDH-E2, anticorps RDHE2, anticorps Rdhe2, anticorps Scdr9, anticorps RGD1565999, anticorps rdhe2, anticorps sdr16c5, anticorps short chain dehydrogenase/reductase family 16C member 5, anticorps short chain dehydrogenase/reductase family 16C, member 5, anticorps short chain dehydrogenase/reductase family 16C member 5 L homeolog, anticorps SDR16C5, anticorps Sdr16c5, anticorps sdr16c5.L
- Sujet
- The specific function of RDHE2 is not yet known.
- Poids moléculaire
- 34 kDa (MW of target protein)
-