ERMN anticorps (Middle Region)

N° du produit ABIN633019

Détail du produit anti-ERMN anticorps

Antigène: ERMN (Ermin, ERM-Like Protein (ERMN))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERMN est non-conjugé

Application: Western Blotting (WB)

Specificité: KIAA1189 antibody was raised against the middle region of Kiaa1189

Purification: Affinity purified

Immunogène: KIAA1189 antibody was raised using the middle region of Kiaa1189 corresponding to a region with amino acids RVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDIS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIAA1189 Blocking Peptide, catalog no. 33R-8249, is also available for use as a blocking control in assays to test for specificity of this KIAA1189 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1189 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ERMN

Antigène: ERMN (Ermin, ERM-Like Protein (ERMN))

Autre désignation: KIAA1189 (ERMN Produits)

Synonymes: anticorps JN, anticorps KIAA1189, anticorps ermin, anticorps A330104H05Rik, anticorps AI854460, anticorps mKIAA1189, anticorps RGD1308367, anticorps juxtanodin, anticorps ermin, anticorps ermin, ERM-like protein, anticorps ERMN, anticorps Ermn

Sujet: The function of KIAA1189 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 34 kDa (MW of target protein)