ERMN anticorps (Middle Region)

N° du produit ABIN633019

Cet anticorps Lapin Polyclonal détecte spécifiquement ERMN dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour ERMN anticorps (Middle Region) (ABIN633019)

Antigène: ERMN (Ermin, ERM-Like Protein (ERMN))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERMN est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ERMN anticorps

Épitope: Middle Region

Specificité: KIAA1189 antibody was raised against the middle region of Kiaa1189

Purification: Affinity purified

Immunogène: KIAA1189 antibody was raised using the middle region of Kiaa1189 corresponding to a region with amino acids RVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDIS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIAA1189 Blocking Peptide, (ABIN5614333), is also available for use as a blocking control in assays to test for specificity of this KIAA1189 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1189 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ERMN

Antigène: ERMN (Ermin, ERM-Like Protein (ERMN))

Autre désignation: KIAA1189

Sujet: The function of KIAA1189 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 34 kDa (MW of target protein)