UTP14A anticorps

N° du produit ABIN633033

Détail du produit anti-UTP14A anticorps

Antigène: UTP14A (UTP14, U3 Small Nucleolar Ribonucleoprotein, Homolog A (UTP14A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UTP14A est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: UTP14 A antibody was raised using a synthetic peptide corresponding to a region with amino acids KWDPVVLKNRQAEQLVFPLEKEEPAIAPIEHVLSGWKARTPLEQEIFNLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UTP14A Blocking Peptide, catalog no. 33R-4729, is also available for use as a blocking control in assays to test for specificity of this UTP14A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UTP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UTP14A

Antigène: UTP14A (UTP14, U3 Small Nucleolar Ribonucleoprotein, Homolog A (UTP14A))

Autre désignation: UTP14A (UTP14A Produits)

Synonymes: anticorps NYCO16, anticorps SDCCAG16, anticorps dJ537K23.3, anticorps 2700066J21Rik, anticorps JsdX, anticorps NY-CO-16, anticorps T25628, anticorps mKIAA0266, anticorps UTP14C, anticorps UTP14A, anticorps utp14a, anticorps UTP14A, small subunit processome component, anticorps UTP14A small subunit processome component, anticorps UTP14, U3 small nucleolar ribonucleoprotein, homolog A-like, anticorps U3 small nucleolar RNA-associated protein 14 homolog A, anticorps UTP14A, small subunit processome component L homeolog, anticorps UTP14A, anticorps Utp14a, anticorps LOC505600, anticorps LOC100083222, anticorps utp14a.L

Sujet: This gene encodes a member of the uridine triphosphate 14 family. As an essential component of a large ribonucleoprotein complex bound to the U3 small nucleolar RNA, the encoded protein is involved in ribosome biogenesis and 18S rRNA synthesis. An autosomal retrotransposed copy of this X-linked gene exists on chromosome 13. Alternative splicing results in multiple transcript variants.

Poids moléculaire: 88 kDa (MW of target protein)