GAD anticorps

N° du produit ABIN633036

Détail du produit anti-GAD anticorps

Antigène: GAD (GAD1) (Glutamate Decarboxylase 1 (Brain, 67kDa) (GAD1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GAD est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GAD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GAD1 Blocking Peptide, catalog no. 33R-5764, is also available for use as a blocking control in assays to test for specificity of this GAD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GAD

Antigène: GAD (GAD1) (Glutamate Decarboxylase 1 (Brain, 67kDa) (GAD1))

Autre désignation: GAD1 (GAD1 Produits)

Synonymes: anticorps CPSQ1, anticorps GAD, anticorps SCP, anticorps GAD-67, anticorps cpsq1, anticorps gad1, anticorps gad1-A, anticorps gad67, anticorps GAD67, anticorps GAD1, anticorps GLUTAMATE DECARBOXYLASE, anticorps GLUTAMATE DECARBOXYLASE 1, anticorps MKP11.30, anticorps MKP11_30, anticorps glutamate decarboxylase, anticorps EP10, anticorps GAD25, anticorps GAD44, anticorps Gad-1, anticorps Gad67, anticorps glutamate decarboxylase 1, anticorps glutamate decarboxylase 1 L homeolog, anticorps glutamate decarboxylase, anticorps glutamate decarboxylase 1b, anticorps GAD1, anticorps gad1.1.L, anticorps GAD, anticorps Gad1, anticorps gad1b

Sujet: This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantigen and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Deficiency in this enzyme has been shown to lead to pyridoxine dependency with seizures. Alternative splicing of this gene results in two products, the predominant 67 kDa form and a less-frequent 25 kDa form.

Poids moléculaire: 67 kDa (MW of target protein)