MFN1 anticorps (Middle Region)

N° du produit ABIN633040

Détail du produit anti-MFN1 anticorps

Antigène: MFN1 (Mitofusin 1 (MFN1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MFN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Mitofusin 1 antibody was raised against the middle region of MFN1

Purification: Affinity purified

Immunogène: Mitofusin 1 antibody was raised using the middle region of MFN1 corresponding to a region with amino acids QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Mitofusin 1 Blocking Peptide, catalog no. 33R-7768, is also available for use as a blocking control in assays to test for specificity of this Mitofusin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MFN1

Antigène: MFN1 (Mitofusin 1 (MFN1))

Autre désignation: Mitofusin 1 (MFN1 Produits)

Synonymes: anticorps mfn1, anticorps zgc:66150, anticorps mitofusin-1, anticorps MFN1, anticorps MFN2, anticorps hfzo1, anticorps hfzo2, anticorps 2310002F04Rik, anticorps 6330416C07Rik, anticorps D3Ertd265e, anticorps HR2, anticorps mKIAA4032, anticorps Fzo1b, anticorps mitofusin 1b, anticorps mitofusin 1, anticorps mitofusin 1 S homeolog, anticorps mfn1b, anticorps MFN1, anticorps mfn1.S, anticorps mfn1, anticorps Mfn1

Sujet: The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting.

Poids moléculaire: 84 kDa (MW of target protein)