PLEKHO1 anticorps (N-Term)

N° du produit ABIN633055

Détail du produit anti-PLEKHO1 anticorps

Antigène: PLEKHO1 (Pleckstrin Homology Domain Containing, Family O Member 1 (PLEKHO1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLEKHO1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PLEKHO1 antibody was raised against the N terminal of PLEKHO1

Purification: Affinity purified

Immunogène: PLEKHO1 antibody was raised using the N terminal of PLEKHO1 corresponding to a region with amino acids MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLEKHO1 Blocking Peptide, catalog no. 33R-6233, is also available for use as a blocking control in assays to test for specificity of this PLEKHO1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLEKHO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLEKHO1

Antigène: PLEKHO1 (Pleckstrin Homology Domain Containing, Family O Member 1 (PLEKHO1))

Autre désignation: PLEKHO1 (PLEKHO1 Produits)

Synonymes: anticorps CKIP-1, anticorps OC120, anticorps 2810052M02Rik, anticorps Ckip1, anticorps JZA-20, anticorps Jza2, anticorps RGD1311487, anticorps ckip-1, anticorps plekho1, anticorps si:dkey-200h23.2, anticorps pleckstrin homology domain containing O1, anticorps pleckstrin homology domain containing, family O member 1, anticorps pleckstrin homology domain containing, family O member 1a, anticorps PLEKHO1, anticorps Plekho1, anticorps plekho1a

Sujet: PLEKHO1 plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP).PLEKHO1 may function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). PLEKHO1 appears to target ATM to the plasma membrane. PLEKHO1 appears to also inhibit tumor cell growth by inhibiting AKT-mediated cell-survival. PLEKHO1 is also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation.

Poids moléculaire: 46 kDa (MW of target protein)