PIGL anticorps (N-Term)

N° du produit ABIN633056

Détail du produit anti-PIGL anticorps

Antigène: PIGL (Phosphatidylinositol Glycan L (PIGL))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIGL est non-conjugé

Application: Western Blotting (WB)

Specificité: PIGL antibody was raised against the N terminal of PIGL

Purification: Affinity purified

Immunogène: PIGL antibody was raised using the N terminal of PIGL corresponding to a region with amino acids MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIGL Blocking Peptide, catalog no. 33R-5892, is also available for use as a blocking control in assays to test for specificity of this PIGL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIGL

Antigène: PIGL (Phosphatidylinositol Glycan L (PIGL))

Autre désignation: PIGL (PIGL Produits)

Synonymes: anticorps CHIME, anticorps Gm737, anticorps phosphatidylinositol glycan anchor biosynthesis class L, anticorps phosphatidylinositol glycan anchor biosynthesis, class L, anticorps PIGL, anticorps Pigl

Sujet: This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Inositol Metabolic Process