NDFIP2 anticorps (Middle Region)
-
- Antigène Voir toutes NDFIP2 Anticorps
- NDFIP2 (Nedd4 Family Interacting Protein 2 (NDFIP2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NDFIP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NDFIP2 antibody was raised against the middle region of NDFIP2
- Purification
- Affinity purified
- Immunogène
- NDFIP2 antibody was raised using the middle region of NDFIP2 corresponding to a region with amino acids SFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL
- Top Product
- Discover our top product NDFIP2 Anticorps primaire
-
anti-Nedd4 Family Interacting Protein 2 (NDFIP2) (AA 1-242) antibody
NDFIP2 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 2C7 unconjugated
anti-Nedd4 Family Interacting Protein 2 (NDFIP2) (Internal Region) antibodyNDFIP2 Reactivité: Humain, Souris WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Nedd4 Family Interacting Protein 2 (NDFIP2) (AA 152-201) antibodyNDFIP2 Reactivité: Humain, Souris, Boeuf (Vache), Chien, Cheval, Rat, Poisson zèbre (Danio rerio), Cobaye, Porc, Roussette (Chauve-souris), Poulet, Singe WB Hôte: Lapin Polyclonal unconjugated
anti-Nedd4 Family Interacting Protein 2 (NDFIP2) (AA 1-242) antibodyNDFIP2 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-Nedd4 Family Interacting Protein 2 (NDFIP2) (AA 251-300) antibodyNDFIP2 Reactivité: Humain, Souris, Boeuf (Vache), Chien, Cheval, Rat, Poisson zèbre (Danio rerio), Porc, Lapin, Roussette (Chauve-souris), Poulet, Singe, Xenopus laevis WB Hôte: Lapin Polyclonal unconjugated
anti-Nedd4 Family Interacting Protein 2 (NDFIP2) (Middle Region) antibodyNDFIP2 Reactivité: Humain, Souris, Boeuf (Vache), Chien, Cheval, Rat, Poisson zèbre (Danio rerio), Cobaye, Porc, Lapin WB Hôte: Lapin Polyclonal unconjugated
anti-Nedd4 Family Interacting Protein 2 (NDFIP2) (N-Term) antibodyNDFIP2 Reactivité: Humain, Souris, Boeuf (Vache), Chien, Cheval, Rat, Poisson zèbre (Danio rerio), Cobaye WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NDFIP2 Blocking Peptide, catalog no. 33R-8419, is also available for use as a blocking control in assays to test for specificity of this NDFIP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDFIP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NDFIP2 (Nedd4 Family Interacting Protein 2 (NDFIP2))
- Autre désignation
- NDFIP2 (NDFIP2 Produits)
- Synonymes
- anticorps MGC68708, anticorps DKFZp459H0627, anticorps N4WBP5A, anticorps 0710001O20Rik, anticorps 2810436B12Rik, anticorps 9130207N19Rik, anticorps N4wbp5a, anticorps mKIAA1165, anticorps Nedd4 family interacting protein 2 S homeolog, anticorps Nedd4 family interacting protein 2, anticorps ndfip2.S, anticorps NDFIP2, anticorps ndfip2, anticorps Ndfip2
- Sujet
- NDFIP2 activates HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2, and consequently modulates the stability of their targets. As a result, NDFIP2 may control many cellular processes. NDFIP2 recruits ITCH, NEDD4 and SMURF2 to endosomal membranes. NDFIP2 may modulate EGFR signaling.
- Poids moléculaire
- 36 kDa (MW of target protein)
- Pathways
- Negative Regulation of Transporter Activity, SARS-CoV-2 Protein Interactome
-
