NDFIP2 anticorps (Middle Region)

N° du produit ABIN633059

L’anticorps anti-NDFIP2 Polyclonal Lapin est utilisé pour la détection de NDFIP2 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour NDFIP2 anticorps (Middle Region) (ABIN633059)

Antigène: NDFIP2 (Nedd4 Family Interacting Protein 2 (NDFIP2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NDFIP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NDFIP2 anticorps

Épitope: Middle Region

Specificité: NDFIP2 antibody was raised against the middle region of NDFIP2

Purification: Affinity purified

Immunogène: NDFIP2 antibody was raised using the middle region of NDFIP2 corresponding to a region with amino acids SFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NDFIP2 Blocking Peptide, (ABIN5614937), is also available for use as a blocking control in assays to test for specificity of this NDFIP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDFIP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NDFIP2

Antigène: NDFIP2 (Nedd4 Family Interacting Protein 2 (NDFIP2))

Autre désignation: NDFIP2

Sujet: NDFIP2 activates HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2, and consequently modulates the stability of their targets. As a result, NDFIP2 may control many cellular processes. NDFIP2 recruits ITCH, NEDD4 and SMURF2 to endosomal membranes. NDFIP2 may modulate EGFR signaling.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity, SARS-CoV-2 Protein Interactome