TMPRSS4 anticorps (Middle Region)

N° du produit ABIN633060

Détail du produit anti-TMPRSS4 anticorps

Antigène: TMPRSS4 (Transmembrane Protease, serine 4 (TMPRSS4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMPRSS4 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMPRSS4 antibody was raised against the middle region of TMPRSS4

Purification: Affinity purified

Immunogène: TMPRSS4 antibody was raised using the middle region of TMPRSS4 corresponding to a region with amino acids LSGSLVSLHCLACGKSLKTPRVVGGEEASVDSWPWQVSIQYDKQHVCGGS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMPRSS4 Blocking Peptide, catalog no. 33R-5428, is also available for use as a blocking control in assays to test for specificity of this TMPRSS4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMPRSS4

Antigène: TMPRSS4 (Transmembrane Protease, serine 4 (TMPRSS4))

Autre désignation: TMPRSS4 (TMPRSS4 Produits)

Synonymes: anticorps tmprss4, anticorps zgc:152909, anticorps CAPH2, anticorps MT-SP2, anticorps TMPRSS3, anticorps mCAP2, anticorps transmembrane protease, serine 4, anticorps transmembrane protease, serine 4a, anticorps TMPRSS4, anticorps tmprss4a, anticorps Tmprss4

Sujet: This gene encodes a member of the serine protease family. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders. This gene was identified as a gene overexpressed in pancreatic carcinoma. The encoded protein is membrane bound with a N-terminal anchor sequence and a glycosylated extracellular region containing the serine protease domain. Multiple transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 48 kDa (MW of target protein)