VAT1 anticorps

N° du produit ABIN633081

Cet anticorps anti-VAT1 Polyclonal Lapin (ABIN633081) détecte spécifiquement VAT1 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour VAT1 anticorps (ABIN633081)

Antigène: VAT1 (Vesicle Amine Transport 1 (VAT1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VAT1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-VAT1 anticorps

Purification: Affinity purified

Immunogène: VAT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VAT1 Blocking Peptide, (ABIN5616949), is also available for use as a blocking control in assays to test for specificity of this VAT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VAT1

Antigène: VAT1 (Vesicle Amine Transport 1 (VAT1))

Autre désignation: VAT1

Sujet: Synaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved in vesicular transport. It belongs to the quinone oxidoreductase subfamily of zinc-containing alcohol dehydrogenase proteins.

Poids moléculaire: 42 kDa (MW of target protein)