VAT1 anticorps

N° du produit ABIN633081

Détail du produit anti-VAT1 anticorps

Antigène: VAT1 (Vesicle Amine Transport 1 (VAT1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VAT1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: VAT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VAT1 Blocking Peptide, catalog no. 33R-7240, is also available for use as a blocking control in assays to test for specificity of this VAT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VAT1

Antigène: VAT1 (Vesicle Amine Transport 1 (VAT1))

Autre désignation: VAT1 (VAT1 Produits)

Synonymes: anticorps VATI, anticorps VAT-1, anticorps SLC18A1, anticorps si:dz163l24.2, anticorps Protein MIB, anticorps vat1, anticorps vesicle amine transport 1, anticorps vesicle amine transport 1 L homeolog, anticorps VAT1, anticorps Vat1, anticorps vat1, anticorps vat1.L

Sujet: Synaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved in vesicular transport. It belongs to the quinone oxidoreductase subfamily of zinc-containing alcohol dehydrogenase proteins.

Poids moléculaire: 42 kDa (MW of target protein)